PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 28410.1 Da    PI: 7.6362
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490238.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  XP_004490238.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.487161IPR002100Transcription factor, MADS-box
CDDcd002653.93E-44278No hitNo description
SuperFamilySSF554551.7E-34287IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-333859IPR002100Transcription factor, MADS-box
PfamPF014869.9E-2584172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.56588178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSG  60
SSMAKTLERY QRSSYGALEV HHPQEHETQR RYQEYLKLKS KVETLQQTQR NILGEKLEHL  120
DINELEQLES QLDSSLRQIR WKKTQQMLDQ LSDLQRKEEM LLETNNILRN KLEEINVALQ  180
PTWEAREQNA HYSCHPPQSE EYYEKAHSNT LQIGCNSSGL NESREVIGSS AHNVSDFMHG  240
WMT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-24751741103Developmental protein SEPALLATA 3
4ox0_B3e-24751741103Developmental protein SEPALLATA 3
4ox0_C3e-24751741103Developmental protein SEPALLATA 3
4ox0_D3e-24751741103Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2364336e-50HM236433.1 Gossypium hirsutum MADS17 mRNA, complete cds.
GenBankJF2718846e-50JF271884.1 Gossypium hirsutum SEPALLATA1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490238.10.0PREDICTED: MADS-box protein CMB1-like isoform X2
SwissprotQ396858e-97CMB1_DIACA; MADS-box protein CMB1
TrEMBLA0A0B2RDK21e-141A0A0B2RDK2_GLYSO; MADS-box protein CMB1
TrEMBLK7K7W61e-141K7K7W6_SOYBN; Uncharacterized protein
STRINGGLYMA02G13401.11e-141(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.22e-77MIKC_MADS family protein